PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P18530_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 834aa    MW: 91675.5 Da    PI: 6.1245
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P18530_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-182279457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             ++t+eq+e+Le+++ ++++ps ++r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr5P18530_001 22 YVRYTAEQVEALERVYSECPKPSSTRRQQLIRECpilaNIEPKQIKVWFQNRRCREKQ 79
                           5789****************************************************97 PP

2START166.22.3e-521593682205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aeea++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  ++++  +++++d++ W ++++  e+     +g 
  GSMUA_Achr5P18530_001 159 IAEEALAEFLSKATGTAVDWVQMPGMKPGPDSIGIVAISHSSSGVAARACGLVNLEPTKASSSIIKDRPAWFHDCRNLEVFTMFPTGn 246
                            799*******************************************************************************999999 PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g+++l +++++a+++l+p Rdf+++Ry+ +l++g++vi+++S++   + p+    +++vRae+lpSg+li+p+++g+s v++v+h d
  GSMUA_Achr5P18530_001 247 gGTIELVYMQMYAPTTLAPaRDFWTLRYTTSLEDGSHVICERSLSGSGSGPNattAHQFVRAEMLPSGYLIRPCEGGGSIVHIVDHLD 334
                            9********************************************99998888999******************************** PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l++++++++lr+l++s+++ ++k++ a+l++ ++
  GSMUA_Achr5P18530_001 335 LEAWSVPEVLRPLYESSRVVAQKMTIAALRHVRQ 368
                            *****************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.6131680IPR001356Homeobox domain
SMARTSM003893.4E-141884IPR001356Homeobox domain
CDDcd000865.45E-162181No hitNo description
SuperFamilySSF466892.95E-162183IPR009057Homeodomain-like
PfamPF000463.0E-162279IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-182379IPR009057Homeodomain-like
CDDcd146861.26E-673111No hitNo description
PROSITE profilePS5084824.53149378IPR002913START domain
CDDcd088751.14E-70153370No hitNo description
Gene3DG3DSA:3.30.530.201.1E-19157364IPR023393START-like domain
SMARTSM002349.0E-44158369IPR002913START domain
SuperFamilySSF559612.06E-35158371No hitNo description
PfamPF018524.9E-50159368IPR002913START domain
PfamPF086702.8E-49691833IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010014Biological Processmeristem initiation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MAAVVAMRSG GMEKHSMDAG KYVRYTAEQV EALERVYSEC PKPSSTRRQQ LIRECPILAN  60
IEPKQIKVWF QNRRCREKQR KETSRLQAVN RKLTAMNKLL MEENERLQKQ VTQLVHENAY  120
MRQQLQNVSL ANDTSCESIV TTPQNPLRDA NNPAGLLSIA EEALAEFLSK ATGTAVDWVQ  180
MPGMKPGPDS IGIVAISHSS SGVAARACGL VNLEPTKASS SIIKDRPAWF HDCRNLEVFT  240
MFPTGNGGTI ELVYMQMYAP TTLAPARDFW TLRYTTSLED GSHVICERSL SGSGSGPNAT  300
TAHQFVRAEM LPSGYLIRPC EGGGSIVHIV DHLDLEAWSV PEVLRPLYES SRVVAQKMTI  360
AALRHVRQIA QETTGEVVCA TGRQPAILRT FGQRLNRGFN DAINGFTDDG WSLMGSDGMD  420
DIVIATNSTK KTGANASSNA FASAGGVICA KASMLLQSVP PALLVRFLRE HRSEWADYNV  480
DAYSAASLKA GVSSFSGSRP NRFSGSQIIM PLAHTVENEE FLEVVRLEGQ ALIQDGAILS  540
RDIHLLQLCC GIDENSLGAC FQLVFAPIDE LFPDDAPLLP SGFRVIPLDA KTNGLSSTRT  600
LDLASSLGVG STVNRSAGDA STDDYNLRSV LTIAFQFPYE VHLQDSIAAM ARQYVRSIVS  660
AIQRVSMAIT RSRPGHGIGQ KLVPGSPEAV TLARWICQSY NYHLGIDLLR YDGETEESLL  720
KMLWHHQDAV LCCTFEMQPI FTFANQAGLD MLETTLVALQ DITLDKIFDE AGRKELHSEF  780
AKLMEQGYLY LPAGTCLSGM GRQVSFEQAV VWKVLGEDND VHCLGLCFVN WSFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401955.10.0PREDICTED: homeobox-leucine zipper protein HOX9
SwissprotA2Z8L40.0HOX9_ORYSI; Homeobox-leucine zipper protein HOX9
TrEMBLM0SZN20.0M0SZN2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P18530_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein